PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009612311.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 344aa    MW: 39077.5 Da    PI: 4.7563
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009612311.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.94e-5361331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k+++ ++el evi+ +d+yk++Pw+Lp k  + +++ ewyfF++rdkky++g+r+nratk gyWkatgkd++v+
  XP_009612311.1   6 LPPGFRFHPTDEELVGYYLKRKTDELEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDMEWYFFCPRDKKYPNGSRTNRATKCGYWKATGKDRKVV 99 
                     79****************************.99**************95344555788************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + k ++vg +ktLvfy+grap g +tdWvmheyrl
  XP_009612311.1 100 C-KPAVVGYRKTLVFYRGRAPLGDRTDWVMHEYRL 133
                     *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-613156IPR003441NAC domain
PROSITE profilePS5100557.7486156IPR003441NAC domain
PfamPF023656.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGGTSLPPGF RFHPTDEELV GYYLKRKTDE LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DMEWYFFCPR DKKYPNGSRT NRATKCGYWK ATGKDRKVVC KPAVVGYRKT LVFYRGRAPL  120
GDRTDWVMHE YRLCDDVSQG TPSFQGPFAL CRVIKRKDIS SKTSDVRRET TSKQDECSSS  180
NEAFTSAVTS NEPLVLSDDM PSTQTTYTCN DSNYSTPINS PYQTTQIGEC ESAMGTNAAN  240
LCMSQNMILD PAKECTSGQS ICGKYPLYDF PNLTSWQPND QYDFTSSSSF PNFRGEVELS  300
GDLSGYGFAP PFSDDGSYME FYRNEDISYK GYNQNNLFGN PDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51516216171NO APICAL MERISTEM PROTEIN
1ut4_B2e-51516216171NO APICAL MERISTEM PROTEIN
1ut7_A2e-51516216171NO APICAL MERISTEM PROTEIN
1ut7_B2e-51516216171NO APICAL MERISTEM PROTEIN
4dul_A2e-51516216171NAC domain-containing protein 19
4dul_B2e-51516216171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612311.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotA4VCM02e-72NAC45_ARATH; NAC domain-containing protein 45
TrEMBLK4C6T80.0K4C6T8_SOLLC; Uncharacterized protein
STRINGSolyc06g061080.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-80NAC domain containing protein 71